PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009110262.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TALE
Protein Properties Length: 487aa    MW: 55256.5 Da    PI: 5.9657
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009110262.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.23.8e-103413781954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  XP_009110262.1 341 FEHflHPYPKESEKMMLAKQTGLSKNQVANWFINARVR 378
                     554459******************************88 PP

2BELL114.84.4e-37199270172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqel++kk kLl++++eVdkrY+qy++q+++++ssFe+vag gsakpYts+Al++iS hFr+L+dai+eqi
  XP_009110262.1 199 ERQELRSKKDKLLTMVDEVDKRYNQYYHQMEALASSFEVVAGFGSAKPYTSVALNRISCHFRSLRDAIKEQI 270
                     79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.0E-44134268IPR006563POX domain
PfamPF075261.5E-44139266IPR006563POX domain
PROSITE profilePS5007112.179319382IPR001356Homeobox domain
CDDcd000864.34E-11322383No hitNo description
SMARTSM003891.5E-9322386IPR001356Homeobox domain
SuperFamilySSF466892.05E-17324389IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-27325388IPR009057Homeodomain-like
PfamPF059208.1E-18339378IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MAVYYPSNVN CYQQEPIYLN HHQQQQQPSS SSSSAAAASF VGGEENVRNE MVFIPPTGLQ  60
NLNGDVPVSS SELTFRDGQG LSLSLLGTQI SLPSFHYHQY SSISAKETPP FNKEMLLLGQ  120
SDPSSGYAGV YNSYNMSSVL RSRYLKPAQG LLDEVVSVEK EMNQLRKKKK GEDFNNSAKE  180
TEGGGGIGGE ISIELSTIER QELRSKKDKL LTMVDEVDKR YNQYYHQMEA LASSFEVVAG  240
FGSAKPYTSV ALNRISCHFR SLRDAIKEQI QMIREKLGEK GGELSLDEQQ GGERIPRLRY  300
LDQRLRQQRT LHQQLGMVRP CWRPQRGLPE SSVSALRAWL FEHFLHPYPK ESEKMMLAKQ  360
TGLSKNQVAN WFINARVRLW KPMIEEMYKE EFGDDASELL TSKSPNSTNQ EDSSSQQENT  420
TNVAFSSEPK PDCTQANEDD PQLHQMNRSG DYDTLMNYQG YDYRYIDGNN QQESRFSSGQ  480
HLHDFVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A9e-16328386563Homeobox protein Meis2
4xrm_B9e-16328386563Homeobox protein Meis2
4xrs_A8e-16328385158Homeobox protein Meis1
4xrs_B8e-16328385158Homeobox protein Meis1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.191860.0bud| flower
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5705080.0AY570508.1 Arabidopsis thaliana BEL1-like homeodomain 5 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009110262.10.0PREDICTED: BEL1-like homeodomain protein 10
RefseqXP_009110263.10.0PREDICTED: BEL1-like homeodomain protein 10
SwissprotQ9FXG80.0BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLM4DJ200.0M4DJ20_BRARP; Uncharacterized protein
STRINGBra016497.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19700.30.0BEL1-like homeodomain 10